CAS Number: 119911-68-1Molecular Weight: 3128.71Salt Form: TFAPurity: >95%Sequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2Sequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2Storage: -20 °C or below
Calcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors.Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRP-α) and CGRP II (CGRP-β)
Categories | Peptides |
---|
Filter | Calcitonin Gene Peptides |
---|