CAS Number: 98824-26-1Molecular Weight: 3792.94Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 [Cys2-Cys7]Sequence (1-letter): ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2Storage: -20 °C or below
Calcitonin Gene Related Peptide II (CGRP II) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRPalpha;) and CGRP II (CGRPbeta;)
Categories | Peptides |
---|
Filter | Calcitonin Gene Peptides |
---|