Growth Hormone Releasing Factor (GHRF, somatocrinin) is a peptide hormone produced in the arcuate nucleus of the hypothamlus. It binds to the GHRH receptor in the anterior pituitary gland and subsequently stimulates growth hormone secretion.
Molecular Weight: 5029.72Salt Form: TFAPurity: >96%Sequence (3-letter): His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OHSequence (1-letter): HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OHStorage: -20 °C or below
Categories | Peptides |
---|
Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
---|